PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G74650.1
Common NameATMYB31, ATY13, F1M20.33, MYB31
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 330aa    MW: 36969.3 Da    PI: 6.7824
Description myb domain protein 31
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G74650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
      AT1G74650.1 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPANTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding46.31e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      AT1G74650.1  67 RGNFTQPEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.849965IPR017930Myb domain
SuperFamilySSF466891.98E-3012108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001673.45E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.00166116IPR017930Myb domain
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.1E-1367112IPR001005SANT/Myb domain
CDDcd001675.29E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRPPCCEKI EVKKGPWTPE EDIILVSYIQ QHGPGNWRSV PANTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQPEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLVMMK  120
FQNGIINENK TNLATDISSC NNNNNGCNHN KRTTNKGQWE KKLQTDINMA KQALFQALSL  180
DQPSSLIPPD PDSPKPHHHS TTTYASSTDN ISKLLQNWTS SSSSKPNTSS VSNNRSSSPG  240
EGGLFDHHSL FSSNSESGSV DEKLNLMSET SMFKGESKPD IDMEATPTTT TTDDQGSLSL  300
IEKWLFDDQG LVQCDDSQED LIDVSLEELK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-261111655159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-261111655159MYB PROTO-ONCOGENE PROTEIN
1h8a_C6e-261111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.230.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260220_at0.0
Expression AtlasAT1G74650-
AtGenExpressAT1G74650-
ATTED-IIAT1G74650-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G74650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDgibberellin, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G74650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0294810.0BT029481.1 Arabidopsis thaliana At1g74650 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177603.10.0myb domain protein 31
SwissprotP813921e-104MYB06_ANTMA; Myb-related protein 306
TrEMBLQ9CA520.0Q9CA52_ARATH; At1g74650
STRINGAT1G74650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  4. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]